C10orf32 (BORCS7) (NM_144591) Human Mass Spec Standard

SKU PH305618

C10orf32 MS Standard C13 and N15-labeled recombinant protein (NP_653192)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205618]
• Predicted MW: 11.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC205618 protein sequence; Red=Cloning site Green=Tags(s); ; MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLR; KMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_653192
• RefSeq Size: 1653
• RefSeq ORF: 315
• Synonyms: C10orf32
• Locus ID: 119032
• UniProt ID: Q96B45
• Cytogenetics: 10q24.32
• Summary: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor.[UniProtKB/Swiss-Prot Function]