SERPINB4 (NM_002974) Human Mass Spec Standard

SKU
PH305612
SERPINB4 MS Standard C13 and N15-labeled recombinant protein (NP_002965)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205612]
Predicted MW 44.9 kDa
Protein Sequence
Protein Sequence
>RC205612 protein sequence
Red=Cloning site Green=Tags(s)

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKA
ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFANAP
EESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV
QMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCV
DLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVV
VVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002965
RefSeq Size 1787
RefSeq ORF 1170
Synonyms LEUPIN; PI11; SCCA-2; SCCA1; SCCA2
Locus ID 6318
UniProt ID P48594
Cytogenetics 18q21.33
Summary The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B3, can be processed into smaller fragments that aggregate to form an autoantigen in psoriasis, probably by causing chronic inflammation. [provided by RefSeq, Jan 2017]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:SERPINB4 (NM_002974) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418979 SERPINB4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418979 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4) 100 ug
$436.00
TP305612 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP790064 Purified recombinant protein of Human serpin peptidase inhibitor, clade B (ovalbumin), member 4 (SERPINB4), with N-terminal HIS tag, expressed in HEK293, 50ug 50 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.