OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF165 (NM_003447) Human Mass Spec Standard

Be the first to review this product
SKU
PH305600
ZNF165 MS Standard C13 and N15-labeled recombinant protein (NP_003438)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800423BM ZNF165 mouse monoclonal antibody,clone 4C1, HRP conjugated 100 ul
$509.00
LY418674 Transient overexpression lysate of zinc finger protein 165 (ZNF165) (as WB positive control) 100 ug
$436.00

Other products for "ZNF165 or NM_003447"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205600
Predicted MW 55.8 kDa
Protein Sequence
Protein Sequence
>RC205600 protein sequence
Red=Cloning site Green=Tags(s)

MATEPKKAAAQNSPEDEGLLIVKIEEEEFIHGQDTCLQRSELLKQELCRQLFRQFCYQDSPGPREALSRL
RELCCQWLKPEIHTKEQILELLVLEQFLTILPGDLQAWVHEHYPESGEEAVTILEDLERGTDEAVLQVQA
HEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLLWDCDNESENSRSMPKLEIFEKIESQRIISG
RISGYISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTVRGEIISHDGCERRLN
LNSNEFTHQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAAVFSGDKTHQCNECG
KAFRHSSKLARHQRIHTGERCYECNECGKSFAESSDLTRHRRIHTGERPFGCKECGRAFNLNSHLIRHQR
IHTREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYECSECGRAFSQSSNLSQHQRIHMRENLLM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003438
RefSeq Size 2411
RefSeq ORF 1455
Synonyms CT53; LD65; ZSCAN7
Locus ID 7718
UniProt ID P49910
Cytogenetics 6p22.1
Summary This gene encodes a member of the Kruppel family of zinc finger proteins. Members of this DNA-binding protein family act as transcriptional regulators. This gene is located within a cluster of zinc finger family members. The encoded protein may play a role in spermatogenesis. provided by RefSeq, Jul 2008
Protein Families Stem cell - Pluripotency, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF165" proteins (3)
SKU Description Size Price
LC418674 Lyophilized ZNF165 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418674 Transient overexpression lysate of zinc finger protein 165 (ZNF165) (as WB positive control) 100 ug
$436.00
TP305600 Recombinant protein of human zinc finger protein 165 (ZNF165), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products