C1orf19 (TSEN15) (NM_052965) Human Mass Spec Standard

SKU
PH305519
TSEN15 MS Standard C13 and N15-labeled recombinant protein (NP_443197)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205519]
Predicted MW 18.6 kDa
Protein Sequence
Protein Sequence
>RC205519 protein sequence
Red=Cloning site Green=Tags(s)

MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDL
MESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFT
LAIVESDSTIVYYKLTDGFMLPDPQNISLRR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443197
RefSeq Size 1998
RefSeq ORF 513
Synonyms C1orf19; PCH2F; sen15
Locus ID 116461
UniProt ID Q8WW01
Cytogenetics 1q25.3
Summary This gene encodes a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from tRNA precursors. Alternative splicing results in multiple transcript variants. There is a pseudogene of this gene on chromosome 17. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:C1orf19 (TSEN15) (NM_052965) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409366 TSEN15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409366 Transient overexpression lysate of tRNA splicing endonuclease 15 homolog (S. cerevisiae) (TSEN15), transcript variant 1 100 ug
$436.00
TP305519 Recombinant protein of human tRNA splicing endonuclease 15 homolog (S. cerevisiae) (TSEN15), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.