C2orf65 (M1AP) (NM_138804) Human Mass Spec Standard

SKU
PH305518
C2orf65 MS Standard C13 and N15-labeled recombinant protein (NP_620159)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205518]
Predicted MW 59.4 kDa
Protein Sequence
Protein Sequence
>RC205518 protein sequence
Red=Cloning site Green=Tags(s)

MHPGRTTGKGPSTHTQIDQQPPRLLIVHIALPSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQ
DQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSRHVTTRAALTYTS
LEITILTSQPGKEVVKQLEEGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDLQ
TIDNDIVSMEIFFKAWLHNSGTDQEQIHLLLSSQCFSNISRPRDNPMCLKCDLQERLLCPSLLAGTADGS
LRMDDPKGDFITLYQMASQSSASHYKLQVIKALKSSGLCESLTYGLPFILRPTSCWQLDWDELETNQQHF
HALCHSLLKREWLLLAKGEPPGPGHSQRIPASTFYVIMPSHSLTLLVKAVATRELMLPSTFPLLPEDPHD
DSLKNVESMLDSLELEPTYNPLHVQSHLYSHLSSIYAKPQGRLHPHWESRAPRKHPCKTGQLQTNRARAT
VAPLPMTPVPGRASKMPAASKSSSDAFFLPSEWEKDPSRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620159
RefSeq Size 2558
RefSeq ORF 1590
Synonyms C2orf65; D6Mm5e; SPATA37; SPGF48
Locus ID 130951
UniProt ID Q8TC57
Cytogenetics 2p13.1
Summary This gene encodes a protein that is likely to function in progression of meiosis. A similar protein in mouse plays a role in gametogenesis in both sexes. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:C2orf65 (M1AP) (NM_138804) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408490 M1AP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408490 Transient overexpression lysate of chromosome 2 open reading frame 65 (C2orf65) 100 ug
$436.00
TP305518 Recombinant protein of human chromosome 2 open reading frame 65 (C2orf65), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.