TRUB1 (NM_139169) Human Mass Spec Standard

SKU
PH305513
TRUB1 MS Standard C13 and N15-labeled recombinant protein (NP_631908)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205513]
Predicted MW 37.3 kDa
Protein Sequence
Protein Sequence
>RC205513 protein sequence
Red=Cloning site Green=Tags(s)

MAASEAAVVSSPSLKTDTSPVLETAGTVAAMAATPSARAAAAVVAAAARTGSEARVSKAALATKLLSLSG
VFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLT
SMLSGSKRYTAIGELGKATDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYSALKKDGQRL
STLMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGGFYIRSLVSDIGKELSSCANVLELTRTKQ
GPFTLEEHALPEDKWTIDDIAQSLEHCSSLFPAELALKKSKPESNEQVLSCEYITLNEPKREDDVIKTC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_631908
RefSeq Size 3412
RefSeq ORF 1047
Synonyms PUS4
Locus ID 142940
UniProt ID Q8WWH5
Cytogenetics 10q25.3
Summary Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:TRUB1 (NM_139169) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408372 TRUB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408372 Transient overexpression lysate of TruB pseudouridine (psi) synthase homolog 1 (E. coli) (TRUB1) 100 ug
$436.00
TP305513 Recombinant protein of human TruB pseudouridine (psi) synthase homolog 1 (E. coli) (TRUB1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.