ATE1 (NM_007041) Human Mass Spec Standard

SKU
PH305461
ATE1 MS Standard C13 and N15-labeled recombinant protein (NP_008972)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205461]
Predicted MW 59 kDa
Protein Sequence
Protein Sequence
>RC205461 protein sequence
Red=Cloning site Green=Tags(s)

MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQT
CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDL
KTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKE
IRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRLVPVSFE
DPEFKSSFSQSFSLYVKYQVAIHQDPPDECGKTEFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKI
IAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG
QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQK
DPSEEAAVLQYASLVGQKCSERMLLFRN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008972
RefSeq Size 4930
RefSeq ORF 1554
Locus ID 11101
UniProt ID O95260
Cytogenetics 10q26.13
Summary This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
Write Your Own Review
You're reviewing:ATE1 (NM_007041) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416240 ATE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424305 ATE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416240 Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 2 100 ug
$436.00
LY424305 Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 1 100 ug
$665.00
TP305461 Recombinant protein of human arginyltransferase 1 (ATE1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.