SLC25A42 (NM_178526) Human Mass Spec Standard

SKU
PH305444
SLC25A42 MS Standard C13 and N15-labeled recombinant protein (NP_848621)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205444]
Predicted MW 35.4 kDa
Protein Sequence
Protein Sequence
>RC205444 protein sequence
Red=Cloning site Green=Tags(s)

MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSA
KEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLFAGAL
AGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYET
LKSLHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGA
VRGLYKGLSMNWVKGPIAVGISFTTFDLMQIMLRHLQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848621
RefSeq Size 3279
RefSeq ORF 954
Synonyms MECREN
Locus ID 284439
UniProt ID Q86VD7
Cytogenetics 19p13.11
Summary This gene encodes a solute carrier family 25 protein. Solute carrier family 25 proteins are localized to mitochondria and play critical roles in the transport of molecules across the inner mitochondrial membrane. The encoded protein is a mitochondrial transporter for coenzyme A (CoA) and adenosine 3',5'-diphosphate. [provided by RefSeq, Feb 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:SLC25A42 (NM_178526) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405906 SLC25A42 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405906 Transient overexpression lysate of solute carrier family 25, member 42 (SLC25A42) 100 ug
$436.00
TP305444 Recombinant protein of human solute carrier family 25, member 42 (SLC25A42), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.