OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLC25A42 (NM_178526) Human Mass Spec Standard

Be the first to review this product
SKU
PH305444
SLC25A42 MS Standard C13 and N15-labeled recombinant protein (NP_848621)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334622 Rabbit Polyclonal Anti-SLC25A42 Antibody
100 ul
$585.00
LY405906 Transient overexpression lysate of solute carrier family 25, member 42 (SLC25A42) (as WB positive control) 100 ug
$436.00

Other products for "SLC25A42 or NM_178526"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205444
Predicted MW 35.4 kDa
Protein Sequence
Protein Sequence
>RC205444 protein sequence
Red=Cloning site Green=Tags(s)

MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSA
KEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLFAGAL
AGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYET
LKSLHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGA
VRGLYKGLSMNWVKGPIAVGISFTTFDLMQIMLRHLQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848621
RefSeq Size 3279
RefSeq ORF 954
Synonyms MECREN
Locus ID 284439
UniProt ID Q86VD7
Cytogenetics 19p13.11
Summary This gene encodes a solute carrier family 25 protein. Solute carrier family 25 proteins are localized to mitochondria and play critical roles in the transport of molecules across the inner mitochondrial membrane. The encoded protein is a mitochondrial transporter for coenzyme A (CoA) and adenosine 3',5'-diphosphate. provided by RefSeq, Feb 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SLC25A42" proteins (3)
SKU Description Size Price
LC405906 Lyophilized SLC25A42 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405906 Transient overexpression lysate of solute carrier family 25, member 42 (SLC25A42) (as WB positive control) 100 ug
$436.00
TP305444 Recombinant protein of human solute carrier family 25, member 42 (SLC25A42), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products