VTA1 (NM_016485) Human Mass Spec Standard

SKU
PH305442
VTA1 MS Standard C13 and N15-labeled recombinant protein (NP_057569)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205442]
Predicted MW 33.9 kDa
Protein Sequence
Protein Sequence
>RC205442 protein sequence
Red=Cloning site Green=Tags(s)

MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL
KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK
HRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT
GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAG
SALQYEDVSTAVQNLQKALKLLTTGRE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057569
RefSeq Size 3371
RefSeq ORF 921
Synonyms C6orf55; DRG-1; DRG1; HSPC228; LIP5; My012; SBP1
Locus ID 51534
UniProt ID Q9NP79
Cytogenetics 6q24.1-q24.2
Summary C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).[supplied by OMIM, Mar 2008]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:VTA1 (NM_016485) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413927 VTA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413927 Transient overexpression lysate of Vps20-associated 1 homolog (S. cerevisiae) (VTA1) 100 ug
$436.00
TP305442 Recombinant protein of human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.