PDHA2 (NM_005390) Human Mass Spec Standard

SKU
PH305416
PDHA2 MS Standard C13 and N15-labeled recombinant protein (NP_005381)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205416]
Predicted MW 42.9 kDa
Protein Sequence
Protein Sequence
>RC205416 protein sequence
Red=Cloning site Green=Tags(s)

MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVR
RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRR
GGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAA
LWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILM
ELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQF
ATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005381
RefSeq Size 1387
RefSeq ORF 1164
Synonyms PDHAL
Locus ID 5161
UniProt ID P29803
Cytogenetics 4q22.3
Summary The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.[UniProtKB/Swiss-Prot Function]
Protein Pathways Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, leucine and isoleucine biosynthesis, Metabolic pathways, Pyruvate metabolism, Valine
Write Your Own Review
You're reviewing:PDHA2 (NM_005390) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417344 PDHA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417344 Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2) 100 ug
$436.00
TP305416 Recombinant protein of human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.