RNF113B (NM_178861) Human Mass Spec Standard

SKU
PH305407
RNF113B MS Standard C13 and N15-labeled recombinant protein (NP_849192)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205407]
Predicted MW 36.3 kDa
Protein Sequence
Protein Sequence
>RC205407 protein sequence
Red=Cloning site Green=Tags(s)

MAAPPSPGRTADQADQVCTFLFKKPGRKGAAGLRKRPACDPEHGESSSSGDEGDTVAQPPRVAPRPRGLH
SWQKAAHGDRRGEEAAPESLDVVYRSTRSAKPVGPEDMGATADFEQDTEKEHHTPTILKCSQRVQEALRG
REHDHIYRGIHSYLRYLKPKDTSMGNSSSGMARKGPIRAPGHLRATVRWDYQPDICKDYKETGFCGFGDS
CKFLHDRSDYKLGWEIERELEEGRYCICEDENHEVGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCA
LEHFRATPRCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_849192
RefSeq Size 1381
RefSeq ORF 966
Synonyms bA10G5.1; RNF161; ZNF183L1
Locus ID 140432
UniProt ID Q8IZP6
Cytogenetics 13q32.2
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RNF113B (NM_178861) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405825 RNF113B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405825 Transient overexpression lysate of ring finger protein 113B (RNF113B) 100 ug
$436.00
TP305407 Recombinant protein of human ring finger protein 113B (RNF113B), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.