OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF113B (NM_178861) Human Mass Spec Standard

Be the first to review this product
SKU
PH305407
RNF113B MS Standard C13 and N15-labeled recombinant protein (NP_849192)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504117 RNF113B mouse monoclonal antibody, clone OTI7A1 (formerly 7A1) 100 ul
$447.00
LY405825 Transient overexpression lysate of ring finger protein 113B (RNF113B) (as WB positive control) 100 ug
$436.00

Other products for "RNF113B or NM_178861"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205407
Predicted MW 36.3 kDa
Protein Sequence
Protein Sequence
>RC205407 protein sequence
Red=Cloning site Green=Tags(s)

MAAPPSPGRTADQADQVCTFLFKKPGRKGAAGLRKRPACDPEHGESSSSGDEGDTVAQPPRVAPRPRGLH
SWQKAAHGDRRGEEAAPESLDVVYRSTRSAKPVGPEDMGATADFEQDTEKEHHTPTILKCSQRVQEALRG
REHDHIYRGIHSYLRYLKPKDTSMGNSSSGMARKGPIRAPGHLRATVRWDYQPDICKDYKETGFCGFGDS
CKFLHDRSDYKLGWEIERELEEGRYCICEDENHEVGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCA
LEHFRATPRCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_849192
RefSeq Size 1381
RefSeq ORF 966
Synonyms bA10G5.1; RNF161; ZNF183L1
Locus ID 140432
UniProt ID Q8IZP6
Cytogenetics 13q32.2
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF113B" proteins (3)
SKU Description Size Price
LC405825 Lyophilized RNF113B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405825 Transient overexpression lysate of ring finger protein 113B (RNF113B) (as WB positive control) 100 ug
$436.00
TP305407 Recombinant protein of human ring finger protein 113B (RNF113B), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products