Calreticulin 3 (CALR3) (NM_145046) Human Mass Spec Standard

SKU
PH305398
CALR3 MS Standard C13 and N15-labeled recombinant protein (NP_659483)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205398]
Predicted MW 45 kDa
Protein Sequence
Protein Sequence
>RC205398 protein sequence
Red=Cloning site Green=Tags(s)

MARALVQFWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQ
NGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFD
IKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETS
PAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKM
KNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKE
EMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659483
RefSeq Size 1295
RefSeq ORF 1152
Synonyms CMH19; CRT2; CT93
Locus ID 125972
UniProt ID Q96L12
Cytogenetics 19p13.11
Summary The protein encoded by this gene belongs to the calreticulin family, members of which are calcium-binding chaperones localized mainly in the endoplasmic reticulum. This protein is also localized to the endoplasmic reticulum lumen, however, its capacity for calcium-binding may be absent or much lower than other family members. This gene is specifically expressed in the testis, and may be required for sperm fertility. Mutation in this gene has been associated with familial hypertrophic cardiomyopathy. [provided by RefSeq, Dec 2011]
Write Your Own Review
You're reviewing:Calreticulin 3 (CALR3) (NM_145046) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403418 CALR3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403418 Transient overexpression lysate of calreticulin 3 (CALR3) 100 ug
$436.00
TP305398 Recombinant protein of human calreticulin 3 (CALR3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721001 Purified recombinant protein of Human calreticulin 3 (CALR3) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.