DAZL (NM_001351) Human Mass Spec Standard

SKU
PH305328
DAZL MS Standard C13 and N15-labeled recombinant protein (NP_001342)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205328]
Predicted MW 33 kDa
Protein Sequence
Protein Sequence
>RC205328 representing NM_001351
Red=Cloning site Green=Tags(s)

MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVK
IITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQ
NVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYS
AVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDK
RVHHFRRSRAMLKSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001342
RefSeq Size 3056
RefSeq ORF 885
Synonyms DAZH; DAZL1; DAZLA; SPGYLA
Locus ID 1618
UniProt ID Q92904
Cytogenetics 3p24.3
Summary The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:DAZL (NM_001351) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400541 DAZL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434157 DAZL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400541 Transient overexpression lysate of deleted in azoospermia-like (DAZL) 100 ug
$436.00
LY434157 Transient overexpression lysate of deleted in azoospermia-like (DAZL), transcript variant 1 100 ug
$436.00
TP305328 Recombinant protein of human deleted in azoospermia-like (DAZL), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.