OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DAZL (NM_001351) Human Mass Spec Standard

Be the first to review this product
SKU
PH305328
DAZL MS Standard C13 and N15-labeled recombinant protein (NP_001342)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375331 DAZL Rabbit polyclonal Antibody
100 ul
$410.00
LY400541 Transient overexpression lysate of deleted in azoospermia-like (DAZL) (as WB positive control) 100 ug
$436.00

Other products for "DAZL or NM_001351"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205328
Predicted MW 33 kDa
Protein Sequence
Protein Sequence
>RC205328 representing NM_001351
Red=Cloning site Green=Tags(s)

MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVK
IITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQ
NVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYS
AVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDK
RVHHFRRSRAMLKSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001342
RefSeq Size 3056
RefSeq ORF 885
Synonyms DAZH; DAZL1; DAZLA; SPGYLA
Locus ID 1618
UniProt ID Q92904
Cytogenetics 3p24.3
Summary The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jun 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DAZL" proteins (5)
SKU Description Size Price
LC400541 Lyophilized DAZL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434157 Lyophilized DAZL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400541 Transient overexpression lysate of deleted in azoospermia-like (DAZL) (as WB positive control) 100 ug
$436.00
LY434157 Transient overexpression lysate of deleted in azoospermia-like (DAZL), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305328 Recombinant protein of human deleted in azoospermia-like (DAZL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products