Aquaporin 1 (AQP1) (NM_198098) Human Mass Spec Standard

SKU
PH305304
AQP1 MS Standard C13 and N15-labeled recombinant protein (NP_932766)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205304]
Predicted MW 28.6 kDa
Protein Sequence
Protein Sequence
>RC205304 protein sequence
Red=Cloning site Green=Tags(s)

MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTTVQDNVKVSLAFGLSIATLAQSVGHI
SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLG
IEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHW
IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_932766
RefSeq Size 2807
RefSeq ORF 807
Synonyms AQP-CHIP; CHIP28; CO
Locus ID 358
UniProt ID P29972
Cytogenetics 7p14.3
Summary This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Write Your Own Review
You're reviewing:Aquaporin 1 (AQP1) (NM_198098) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403670 AQP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403670 Transient overexpression lysate of aquaporin 1 (Colton blood group) (AQP1) 100 ug
$436.00
TP305304 Recombinant protein of human aquaporin 1 (Colton blood group) (AQP1), 20 µg 20 ug
$867.00
TP329599 Purified recombinant protein of Homo sapiens aquaporin 1 (Colton blood group) (AQP1), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.