GNG4 (NM_004485) Human Mass Spec Standard

SKU PH305299

GNG4 MS Standard C13 and N15-labeled recombinant protein (NP_004476)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205299]
• Predicted MW: 8.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC205299 protein sequence; Red=Cloning site Green=Tags(s); ; MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF; FCTIL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004476
• RefSeq Size: 4885
• RefSeq ORF: 225
• Locus ID: 2786
• UniProt ID: P50150
• Cytogenetics: 1q42.3
• Summary: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway