INSIG2 (NM_016133) Human Mass Spec Standard

SKU
PH305274
INSIG2 MS Standard C13 and N15-labeled recombinant protein (NP_057217)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205274]
Predicted MW 24.8 kDa
Protein Sequence
Protein Sequence
>RC205274 protein sequence
Red=Cloning site Green=Tags(s)

MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSA
WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAAL
SIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQL
AMYECKVIAEKSHQE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057217
RefSeq Size 2592
RefSeq ORF 675
Synonyms INSIG-2
Locus ID 51141
UniProt ID Q9Y5U4
Cytogenetics 2q14.1-q14.2
Summary The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:INSIG2 (NM_016133) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402504 INSIG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402504 Transient overexpression lysate of insulin induced gene 2 (INSIG2) 100 ug
$436.00
TP305274 Recombinant protein of human insulin induced gene 2 (INSIG2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.