ABHD2 (NM_007011) Human Mass Spec Standard

SKU
PH305260
ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_008942)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205260]
Predicted MW 48.3 kDa
Protein Sequence
Protein Sequence
>RC205260 protein sequence
Red=Cloning site Green=Tags(s)

MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPL
IWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEK
QYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGG
NIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCQRFYNFLMADNMKKIILSHRQALFGDHV
KKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE
SLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQV
EADLE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008942
RefSeq Size 9159
RefSeq ORF 1275
Synonyms HS1-2; LABH2; PHPS1-2
Locus ID 11057
UniProt ID P08910
Cytogenetics 15q26.1
Summary This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jan 2017]
Write Your Own Review
You're reviewing:ABHD2 (NM_007011) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310637 ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_690888) 10 ug
$3,255.00
LC402075 ABHD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407219 ABHD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402075 Transient overexpression lysate of abhydrolase domain containing 2 (ABHD2), transcript variant 1 100 ug
$436.00
LY407219 Transient overexpression lysate of abhydrolase domain containing 2 (ABHD2), transcript variant 2 100 ug
$436.00
TP305260 Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 1, 20 µg 20 ug
$737.00
TP310637 Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.