CRHBP (NM_001882) Human Mass Spec Standard

SKU
PH305258
CRHBP MS Standard C13 and N15-labeled recombinant protein (NP_001873)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205258]
Predicted MW 36 kDa
Protein Sequence
Protein Sequence
>RC205258 representing NM_001882
Red=Cloning site Green=Tags(s)

MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF
TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF
CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII
YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT
VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001873
RefSeq Size 1854
RefSeq ORF 966
Synonyms CRF-BP; CRFBP
Locus ID 1393
UniProt ID P24387
Cytogenetics 5q13.3
Summary Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CRHBP (NM_001882) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419679 CRHBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419679 Transient overexpression lysate of corticotropin releasing hormone binding protein (CRHBP) 100 ug
$436.00
TP305258 Recombinant protein of human corticotropin releasing hormone binding protein (CRHBP), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.