WIF1 (NM_007191) Human Mass Spec Standard

SKU
PH305256
WIF1 MS Standard C13 and N15-labeled recombinant protein (NP_009122)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205256]
Predicted MW 41.5 kDa
Protein Sequence
Protein Sequence
>RC205256 protein sequence
Red=Cloning site Green=Tags(s)

MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDF
RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPC
LGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCE
KALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQ
PCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALR
PAGAQLRQHTPSLKKAEERRDPPESNYIW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009122
RefSeq Size 2240
RefSeq ORF 1137
Synonyms WIF-1
Locus ID 11197
UniProt ID Q9Y5W5
Cytogenetics 12q14.3
Summary The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers. [provided by RefSeq, Jun 2010]
Protein Families Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway
Protein Pathways Wnt signaling pathway
Write Your Own Review
You're reviewing:WIF1 (NM_007191) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402102 WIF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402102 Transient overexpression lysate of WNT inhibitory factor 1 (WIF1) 100 ug
$436.00
TP305256 Recombinant protein of human WNT inhibitory factor 1 (WIF1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720656 Purified recombinant protein of Human WNT inhibitory factor 1 (WIF1) 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.