TKTL1 (NM_012253) Human Mass Spec Standard

SKU
PH305218
TKTL1 MS Standard C13 and N15-labeled recombinant protein (NP_036385)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205218]
Predicted MW 65.4 kDa
Protein Sequence
Protein Sequence
>RC205218 protein sequence
Red=Cloning site Green=Tags(s)

MADAEARAEFPEEARPDRGTLQVFQDMASRLRIHSIRATCSTSSGHPTSCSSSSEIMSVLFFYIMRYKQS
DPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSDGESSEGSVWEAMAF
ASYYSLDNLVATFDVNRLGHSGALPAEHCINIYQRRCEAFGWNTYVVDGRDVEALCQVFWQASQVKHKPT
AVVAKTFKGRGTPSIEDAESWHAKPMPRERADAIIKLIESQIQTSRNLDPQPPIEDSPEVNITDVRMTSP
PDYRVGDKIATRKACGLALAKLGYANNRVVVLDGDTRYSTFSEIFNKEYPERFIECFMAEQNMVSVALGC
ASRGRTIAFASTFAAFLTRAFDHIRIGGLAESNINIIGSHCGVSVGDDGASQMALEDIAMFRTIPKCTIF
YPTDAVSTEHAVALAANAKGMCFIRTTRPETMVIYTPQERFEIGQAKVLRHCVSDKVTVIGAGITVYEAL
AAADELSKQDIFIRVIDLFTIKPLDVATIVSSAKATEGRIITVEDHYPQGGIGEAVCAAVSMDPDIQVHS
LAVSGVPQSGKSEELLDMYGISARHIIVAVKCMLLN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036385
RefSeq Size 2652
RefSeq ORF 1788
Synonyms TKR; TKT2
Locus ID 8277
UniProt ID P51854
Cytogenetics Xq28
Summary The protein encoded by this gene is a transketolase that acts as a homodimer and catalyzes the conversion of sedoheptulose 7-phosphate and D-glyceraldehyde 3-phosphate to D-ribose 5-phosphate and D-xylulose 5-phosphate. This reaction links the pentose phosphate pathway with the glycolytic pathway. Variations in this gene may be the cause of Wernicke-Korsakoff syndrome. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pentose phosphate pathway
Write Your Own Review
You're reviewing:TKTL1 (NM_012253) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415879 TKTL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431505 TKTL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415879 Transient overexpression lysate of transketolase-like 1 (TKTL1), transcript variant 1 100 ug
$436.00
LY431505 Transient overexpression lysate of transketolase-like 1 (TKTL1), transcript variant 2 100 ug
$436.00
TP305218 Purified recombinant protein of Homo sapiens transketolase-like 1 (TKTL1), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.