PLSCR4 (NM_020353) Human Mass Spec Standard

SKU
PH305184
PLSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_065086)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205184]
Predicted MW 37 kDa
Protein Sequence
Protein Sequence
>RC205184 protein sequence
Red=Cloning site Green=Tags(s)

MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGYYSPQQPSTFP
LYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETN
NRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSARQELE
VQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWN
GLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSPPQRSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065086
RefSeq Size 3312
RefSeq ORF 987
Synonyms TRA1
Locus ID 57088
UniProt ID Q9NRQ2
Cytogenetics 3q24
Summary May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PLSCR4 (NM_020353) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412524 PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426943 PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426944 PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432718 PLSCR4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412524 Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 2 100 ug
$436.00
LY426943 Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 1 100 ug
$436.00
LY426944 Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 3 100 ug
$436.00
LY432718 Transient overexpression lysate of phospholipid scramblase 4 (PLSCR4), transcript variant 5 100 ug
$436.00
TP305184 Recombinant protein of human phospholipid scramblase 4 (PLSCR4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.