ERLIN1 (NM_006459) Human Mass Spec Standard

SKU
PH305137
ERLIN1 MS Standard C13 and N15-labeled recombinant protein (NP_006450)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205137]
Predicted MW 38.9 kDa
Protein Sequence
Protein Sequence
>RC205137 protein sequence
Red=Cloning site Green=Tags(s)

MTQARVLVAAVVGLVAVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDE
VKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIEL
FDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETE
RKKAVIEAEKIAQVAKIRFQQKVMEKETEKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEY
LELKKYQAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGRESSLPSKEALEPSGENVIQNKESTG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006450
RefSeq Size 3450
RefSeq ORF 1038
Synonyms C10orf69; Erlin-1; KE04; KEO4; SPFH1; SPG62
Locus ID 10613
UniProt ID O75477
Cytogenetics 10q24.31
Summary The protein encoded by this gene is part of a protein complex that mediates degradation of inositol 1,4,5-trisphosphate receptors in the endoplasmic reticulum. The encoded protein also binds cholesterol and regulates the SREBP signaling pathway, which promotes cellular cholesterol homeostasis. Defects in this gene have been associated with spastic paraplegia 62. [provided by RefSeq, Dec 2016]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ERLIN1 (NM_006459) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416643 ERLIN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420288 ERLIN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416643 Transient overexpression lysate of ER lipid raft associated 1 (ERLIN1) 100 ug
$436.00
LY420288 Transient overexpression lysate of ER lipid raft associated 1 (ERLIN1) 100 ug
$436.00
TP305137 Recombinant protein of human ER lipid raft associated 1 (ERLIN1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.