AASDHPPT (NM_015423) Human Mass Spec Standard

SKU
PH305091
AASDHPPT MS Standard C13 and N15-labeled recombinant protein (NP_056238)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205091]
Predicted MW 35.8 kDa
Protein Sequence
Protein Sequence
>RC205091 protein sequence
Red=Cloning site Green=Tags(s)

MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKL
VAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGS
IPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIG
QVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSS
AVPMTPEDPSFWDCFCFTEEIPIRNGTKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056238
RefSeq Size 2880
RefSeq ORF 927
Synonyms AASD-PPT; ACPS; CGI-80; LYS2; LYS5
Locus ID 60496
UniProt ID Q9NRN7
Cytogenetics 11q22.3
Summary The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008]
Protein Pathways Lysine biosynthesis, Lysine degradation, Metabolic pathways
Write Your Own Review
You're reviewing:AASDHPPT (NM_015423) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414583 AASDHPPT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414583 Transient overexpression lysate of aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT) 100 ug
$436.00
TP305091 Recombinant protein of human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.