Viperin (RSAD2) (NM_080657) Human Mass Spec Standard

SKU
PH305066
RSAD2 MS Standard C13 and N15-labeled recombinant protein (NP_542388)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205066]
Predicted MW 42.2 kDa
Protein Sequence
Protein Sequence
>RC205066 protein sequence
Red=Cloning site Green=Tags(s)

MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLRATKRRKQQLVLRGPDETKEEEEDPPLPT
TPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLV
RFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRW
CRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFL
ERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY
IWSKADLKLDW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542388
RefSeq Size 3512
RefSeq ORF 1083
Synonyms cig5; cig33; vig1
Locus ID 91543
UniProt ID Q8WXG1
Cytogenetics 2p25.2
Summary The protein encoded by this gene is an interferon-inducible antiviral protein that belongs to the S-adenosyl-L-methionine (SAM) superfamily of enzymes. The protein plays a role in cellular antiviral response and innate immune signaling. Antiviral effects result from inhibition of viral RNA replication, interference in the secretory pathway, binding to viral proteins and dysregulation of cellular lipid metabolism. The protein has been found to inhibit both DNA and RNA viruses, including influenza virus, human immunodeficiency virus (HIV-1) and Zika virus. [provided by RefSeq, Sep 2020]
Write Your Own Review
You're reviewing:Viperin (RSAD2) (NM_080657) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403324 RSAD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403324 Transient overexpression lysate of radical S-adenosyl methionine domain containing 2 (RSAD2) 100 ug
$436.00
TP305066 Recombinant protein of human radical S-adenosyl methionine domain containing 2 (RSAD2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.