RAB2B (NM_032846) Human Mass Spec Standard

SKU
PH305033
RAB2B MS Standard C13 and N15-labeled recombinant protein (NP_116235)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205033]
Predicted MW 24.2 kDa
Protein Sequence
Protein Sequence
>RC205033 protein sequence
Red=Cloning site Green=Tags(s)

MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRS
ITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFARE
HGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIG
SNSGCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116235
RefSeq Size 2956
RefSeq ORF 648
Locus ID 84932
UniProt ID Q8WUD1
Cytogenetics 14q11.2
Summary Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508.[supplied by OMIM, Apr 2006]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB2B (NM_032846) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409882 RAB2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431135 RAB2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409882 Transient overexpression lysate of RAB2B, member RAS oncogene family (RAB2B), transcript variant 1 100 ug
$436.00
LY431135 Transient overexpression lysate of RAB2B, member RAS oncogene family (RAB2B), transcript variant 2 100 ug
$436.00
TP305033 Recombinant protein of human RAB2B, member RAS oncogene family (RAB2B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.