UPRT (NM_145052) Human Mass Spec Standard

SKU
PH305030
UPRT MS Standard C13 and N15-labeled recombinant protein (NP_659489)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205030]
Predicted MW 33.8 kDa
Protein Sequence
Protein Sequence
>RC205030 protein sequence
Red=Cloning site Green=Tags(s)

MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACG
GSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSA
DRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQ
SDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSII
QEFPEITILTTEVHPVAPTHFGQKYFGTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659489
RefSeq Size 2512
RefSeq ORF 927
Synonyms FUR1; UPP
Locus ID 139596
UniProt ID Q96BW1
Cytogenetics Xq13.3
Summary This gene encodes uracil phosphoribosyltransferase, which catalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP). This reaction is an important part of nucleotide metabolism, specifically the pyrimidine salvage pathway. The enzyme localizes to the nucleus and cytoplasm. The protein is a potential target for rational design of drugs to treat parasitic infections and cancer. [provided by RefSeq, Nov 2009]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pyrimidine metabolism
Write Your Own Review
You're reviewing:UPRT (NM_145052) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408068 UPRT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408068 Transient overexpression lysate of uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae) (UPRT), transcript variant 1 100 ug
$436.00
TP305030 Recombinant protein of human uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae) (UPRT), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721007 Purified recombinant protein of Human uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae) (UPRT), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.