LYPLAL1 (NM_138794) Human Mass Spec Standard

SKU
PH304998
LYPLAL1 MS Standard C13 and N15-labeled recombinant protein (NP_620149)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204998]
Predicted MW 26.3 kDa
Protein Sequence
Protein Sequence
>RC204998 protein sequence
Red=Cloning site Green=Tags(s)

MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMK
GGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQD
VAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVY
HELSKTELDILKLWILTKLPGEMEKQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620149
RefSeq Size 1922
RefSeq ORF 711
Synonyms Q96AV0
Locus ID 127018
UniProt ID Q5VWZ2
Cytogenetics 1q41
Summary Has depalmitoylating activity toward KCNMA1. Does not exhibit phospholipase nor triacylglycerol lipase activity, able to hydrolyze only short chain substrates due to its shallow active site.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LYPLAL1 (NM_138794) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408395 LYPLAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408395 Transient overexpression lysate of lysophospholipase-like 1 (LYPLAL1) 100 ug
$436.00
TP304998 Recombinant protein of human lysophospholipase-like 1 (LYPLAL1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.