C9orf78 (NM_016520) Human Mass Spec Standard

SKU
PH304997
C9orf78 MS Standard C13 and N15-labeled recombinant protein (NP_057604)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204997]
Predicted MW 33.7 kDa
Protein Sequence
Protein Sequence
>RC204997 protein sequence
Red=Cloning site Green=Tags(s)

MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQEETTLVDDPFQ
MKTGGMVDMKKLKERGKDKISEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKGIVEHEEQKVKSK
NAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQSKKKDSET
SFVPTNMAVNYVQHNRFYHEELNAPIRRNKEEPKARPLRVGDTEKPEPERSPPNRKRPANEKATDDYHYE
KFKKMNRRY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057604
RefSeq Size 1835
RefSeq ORF 867
Synonyms bA409K20.3; CSU2; HCA59; HSPC220
Locus ID 51759
UniProt ID Q9NZ63
Cytogenetics 9q34.11
Summary Involved in the regulation of telomeric heterochromatin assembly and control of telomere length.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C9orf78 (NM_016520) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413954 C9orf78 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413954 Transient overexpression lysate of chromosome 9 open reading frame 78 (C9orf78) 100 ug
$436.00
TP304997 Recombinant protein of human chromosome 9 open reading frame 78 (C9orf78), 20 µg 20 ug
$737.00
TP710188 Purified recombinant protein of Human chromosome 9 open reading frame 78 (C9orf78), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.