PECI (ECI2) (NM_006117) Human Mass Spec Standard

SKU
PH304994
PECI MS Standard C13 and N15-labeled recombinant protein (NP_006108)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204994]
Predicted MW 40.2 kDa
Protein Sequence
Protein Sequence
>RC204994 protein sequence
Red=Cloning site Green=Tags(s)

MNRTAMRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALG
SLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYH
EIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIA
VVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGE
ACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDEC
TNAVVNFLSRKSKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006108
RefSeq Size 1410
RefSeq ORF 1092
Synonyms ACBD2; dJ1013A10.3; DRS-1; DRS1; HCA88; PECI
Locus ID 10455
UniProt ID O75521
Cytogenetics 6p25.2
Summary This gene encodes a member of the hydratase/isomerase superfamily. The protein encoded is a key mitochondrial enzyme involved in beta-oxidation of unsaturated fatty acids. It catalyzes the transformation of 3-cis and 3-trans-enoyl-CoA esters arising during the stepwise degradation of cis-, mono-, and polyunsaturated fatty acids to the 2-trans-enoyl-CoA intermediates. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011]
Protein Pathways Fatty acid metabolism
Write Your Own Review
You're reviewing:PECI (ECI2) (NM_006117) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401844 ECI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431874 ECI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401844 Transient overexpression lysate of peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1 100 ug
$436.00
LY431874 Transient overexpression lysate of enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3 100 ug
$436.00
TP304994 Recombinant protein of human peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP328846 Recombinant protein of human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.