Pregnancy Specific Glycoprotein 1 (PSG1) (NM_006905) Human Mass Spec Standard

SKU
PH304978
PSG1 MS Standard C13 and N15-labeled recombinant protein (NP_008836)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204978]
Predicted MW 47.9 kDa
Protein Sequence
Protein Sequence
>RC204978 protein sequence
Red=Cloning site Green=Tags(s)

MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKG
QMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTF
TLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKY
TAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSL
PVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVL
YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSGKWIPA
SLAIGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008836
RefSeq Size 2306
RefSeq ORF 1278
Synonyms B1G1; CD66f; DHFRP2; FL-NCA-1/2; PBG1; PS-beta-C/D; PS-beta-G-1; PSBG-1; PSBG1; PSG95; PSGGA; PSGIIA; SP1
Locus ID 5669
UniProt ID P11464
Cytogenetics 19q13.2
Summary The human placenta is a multihormonal endocrine organ that produces hormones, enzymes, and other molecules that support fetal survival and development. Pregnancy-specific beta-1-glycoprotein (PSBG, PSG) is a major product of the syncytiotrophoblast, reaching concentrations of 100 to 290 mg/l at term in the serum of pregnant women (Horne et al., 1976 [PubMed 971765]). PSG is a member of the immunoglobulin (Ig) superfamily (Watanabe and Chou, 1988 [PubMed 3257488]; Streydio et al., 1988 [PubMed 3260773]).[supplied by OMIM, Oct 2009]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:Pregnancy Specific Glycoprotein 1 (PSG1) (NM_006905) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402056 PSG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433043 PSG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402056 Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 1 (PSG1) 100 ug
$436.00
LY433043 Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 1 (PSG1), transcript variant 3 100 ug
$436.00
TP304978 Recombinant protein of human pregnancy specific beta-1-glycoprotein 1 (PSG1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.