VAMP5 (NM_006634) Human Mass Spec Standard

SKU PH304973

VAMP5 MS Standard C13 and N15-labeled recombinant protein (NP_006625)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204973]
• Predicted MW: 12.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC204973 protein sequence; Red=Cloning site Green=Tags(s); ; MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR; ICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006625
• RefSeq Size: 694
• RefSeq ORF: 348
• Locus ID: 10791
• UniProt ID: O95183
• Cytogenetics: 2p11.2
• Summary: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport