SERPINE2 (NM_006216) Human Mass Spec Standard

SKU
PH304904
SERPINE2 MS Standard C13 and N15-labeled recombinant protein (NP_006207)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204904]
Predicted MW 44 kDa
Protein Sequence
Protein Sequence
>RC204904 protein sequence
Red=Cloning site Green=Tags(s)

MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGAD
GRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRN
VNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAA
DGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSW
MSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSED
GTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006207
RefSeq Size 2259
RefSeq ORF 1194
Synonyms GDN; GDNPF; PI-7; PI7; PN-1; PN1; PNI
Locus ID 5270
UniProt ID P07093
Cytogenetics 2q36.1
Summary This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for chronic obstructive pulmonary disease and for emphysema. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:SERPINE2 (NM_006216) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416795 SERPINE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416795 Transient overexpression lysate of serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2 (SERPINE2), transcript variant 1 100 ug
$436.00
TP304904 Recombinant protein of human serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2 (SERPINE2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.