IRAK (IRAK1) (NM_001025243) Human Mass Spec Standard

SKU
PH304869
IRAK1 MS Standard C13 and N15-labeled recombinant protein (NP_001020414)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204869]
Predicted MW 68 kDa
Protein Sequence
Protein Sequence
>RC204869 protein sequence
Red=Cloning site Green=Tags(s)

MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVL
WPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSAS
TFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPSPFCWPLCEISRGTH
NFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQ
NGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDE
RLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLVYERLEKLQAVVAGVPGHLEAASCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSG
ASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRP
TAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDE
FQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020414
RefSeq Size 3352
RefSeq ORF 1899
Synonyms IRAK; pelle
Locus ID 3654
UniProt ID P51617
Cytogenetics Xq28
Summary This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation of the transcription factor NF-kappa B. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase, Transcription Factors
Protein Pathways Apoptosis, Neurotrophin signaling pathway, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:IRAK (IRAK1) (NM_001025243) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400603 IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422494 IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422495 IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425491 IRAK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400603 Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 1 100 ug
$665.00
LY422494 Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 2 100 ug
$665.00
LY422495 Transient overexpression lysate of interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 3 100 ug
$436.00
TP304869 Recombinant protein of human interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 3, 20 µg 20 ug
$737.00
TP761632 Purified recombinant protein of Human interleukin-1 receptor-associated kinase 1 (IRAK1), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.