NMNAT1 (NM_022787) Human Mass Spec Standard

SKU
PH304825
NMNAT1 MS Standard C13 and N15-labeled recombinant protein (NP_073624)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204825]
Predicted MW 31.9 kDa
Protein Sequence
Protein Sequence
>RC204825 protein sequence
Red=Cloning site Green=Tags(s)

MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMA
ELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKS
LEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNI
HVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073624
RefSeq Size 3781
RefSeq ORF 837
Synonyms LCA9; NMNAT; PNAT1; SHILCA
Locus ID 64802
UniProt ID Q9HAN9
Cytogenetics 1p36.22
Summary This gene encodes an enzyme which catalyzes a key step in the biosynthesis of nicotinamide adenine dinucleotide (NAD). The encoded enzyme is one of several nicotinamide nucleotide adenylyltransferases, and is specifically localized to the cell nucleus. Activity of this protein leads to the activation of a nuclear deacetylase that functions in the protection of damaged neurons. Mutations in this gene have been associated with Leber congenital amaurosis 9. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14, and 15. [provided by RefSeq, Jul 2014]
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism
Write Your Own Review
You're reviewing:NMNAT1 (NM_022787) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402948 NMNAT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402948 Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 1 (NMNAT1) 100 ug
$436.00
TP304825 Recombinant protein of human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.