RRAS (NM_006270) Human Mass Spec Standard

SKU
PH304820
RRAS MS Standard C13 and N15-labeled recombinant protein (NP_006261)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204820]
Predicted MW 23.5 kDa
Protein Sequence
Protein Sequence
>RC204820 protein sequence
Red=Cloning site Green=Tags(s)

MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKIC
SVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV
GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKG
GGCPCVLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006261
RefSeq Size 1013
RefSeq ORF 654
Synonyms R-Ras
Locus ID 6237
UniProt ID P10301
Cytogenetics 19q13.33
Summary The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. [provided by RefSeq, Jul 2015]
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction
Write Your Own Review
You're reviewing:RRAS (NM_006270) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416758 RRAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416758 Transient overexpression lysate of related RAS viral (r-ras) oncogene homolog (RRAS) 100 ug
$436.00
TP304820 Recombinant protein of human related RAS viral (r-ras) oncogene homolog (RRAS), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.