BAP31 (BCAP31) (NM_005745) Human Mass Spec Standard

SKU
PH304804
BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_005736)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204804]
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC204804 protein sequence
Red=Cloning site Green=Tags(s)

MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREI
REYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQA
ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVL
AMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005736
RefSeq Size 1417
RefSeq ORF 738
Synonyms 6C6-AG; BAP31; CDM; DDCH; DXS1357E
Locus ID 10134
UniProt ID P51572
Cytogenetics Xq28
Summary This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. [provided by RefSeq, Jan 2012]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:BAP31 (BCAP31) (NM_005745) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH326633 BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132913) 10 ug
$3,255.00
PH327334 BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132929) 10 ug
$3,255.00
LC401750 BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427957 BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427962 BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401750 Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 2 100 ug
$436.00
LY427957 Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 3 100 ug
$436.00
LY427962 Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 1 100 ug
$436.00
TP304804 Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 2, 20 µg 20 ug
$737.00
TP326633 Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 3, 20 µg 20 ug
$737.00
TP327334 Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.