BAP31 (BCAP31) (NM_005745) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC204804] |
Predicted MW | 28 kDa |
Protein Sequence |
Protein Sequence
>RC204804 protein sequence
Red=Cloning site Green=Tags(s) MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREI REYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQA ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVL AMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005736 |
RefSeq Size | 1417 |
RefSeq ORF | 738 |
Synonyms | 6C6-AG; BAP31; CDM; DDCH; DXS1357E |
Locus ID | 10134 |
UniProt ID | P51572 |
Cytogenetics | Xq28 |
Summary | This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH326633 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132913) | 10 ug |
$3,255.00
|
|
PH327334 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132929) | 10 ug |
$3,255.00
|
|
LC401750 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427957 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427962 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401750 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 2 | 100 ug |
$436.00
|
|
LY427957 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 3 | 100 ug |
$436.00
|
|
LY427962 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 1 | 100 ug |
$436.00
|
|
TP304804 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP326633 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP327334 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.