SERF2 (NM_001018108) Human Mass Spec Standard

SKU PH304784

SERF2 MS Standard C13 and N15-labeled recombinant protein (NP_001018118)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204784]
• Predicted MW: 6.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC204784 protein sequence; Red=Cloning site Green=Tags(s); ; MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001018118
• RefSeq Size: 3048
• RefSeq ORF: 177
• Synonyms: 4F5REL; FAM2C; H4F5REL; HsT17089
• Locus ID: 10169
• UniProt ID: P84101
• Cytogenetics: 15q15.3
• Summary: Positive regulator of amyloid protein aggregation and proteotoxicity (PubMed:20723760). Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates (PubMed:20723760).[UniProtKB/Swiss-Prot Function]