ARHGAP15 (NM_018460) Human Mass Spec Standard

SKU
PH304782
ARHGAP15 MS Standard C13 and N15-labeled recombinant protein (NP_060930)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204782]
Predicted MW 54.5 kDa
Protein Sequence
Protein Sequence
>RC204782 protein sequence
Red=Cloning site Green=Tags(s)

MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHRRNHSQHILKD
VIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKESKQQALSNMKTGHKPESVDLC
GAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDSSCPSRNLELFKIQRS
SSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFG
SHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHV
VTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVPFGHLTKIVAKA
SKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060930
RefSeq Size 1774
RefSeq ORF 1425
Synonyms BM046
Locus ID 55843
UniProt ID Q53QZ3
Cytogenetics 2q22.2-q22.3
Summary RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:ARHGAP15 (NM_018460) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413038 ARHGAP15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413038 Transient overexpression lysate of Rho GTPase activating protein 15 (ARHGAP15) 100 ug
$436.00
TP304782 Recombinant protein of human Rho GTPase activating protein 15 (ARHGAP15), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.