S100Z (NM_130772) Human Mass Spec Standard

SKU
PH304754
S100Z MS Standard C13 and N15-labeled recombinant protein (NP_570128)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204754]
Predicted MW 11.6 kDa
Protein Sequence
Protein Sequence
>RC204754 protein sequence
Red=Cloning site Green=Tags(s)

MPTQLEMAMDTMIRIFHRYSGKARKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEV
DFNEFVVMVAALTVACNDYFVEQLKKKGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_570128
RefSeq Size 1164
RefSeq ORF 297
Synonyms Gm625; S100-zeta
Locus ID 170591
UniProt ID Q8WXG8
Cytogenetics 5q13.3
Summary Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins, see MIM 114085.[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:S100Z (NM_130772) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408935 S100Z HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408935 Transient overexpression lysate of S100 calcium binding protein Z (S100Z) 100 ug
$436.00
TP304754 Recombinant protein of human S100 calcium binding protein Z (S100Z), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.