beta Sarcoglycan (SGCB) (NM_000232) Human Mass Spec Standard

CAT#: PH304699

SGCB MS Standard C13 and N15-labeled recombinant protein (NP_000223)

Product Images

Coomassie blue staining of purified SGCB protein (Cat# TP304699). The protein was produced from HEK293T cells transfected with SGCB cDNA clone (Cat# RC204699) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204699
• Predicted MW: 34.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204699 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVII
  LLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN
  NQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQKASTERITS
  NATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSG
  DWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000223
• RefSeq Size: 4295
• RefSeq ORF: 954
• Synonyms: A3b; LGMD2E; LGMDR4; SGC
• Locus ID: 6443
• UniProt ID: Q16585, Q5U0N0
• Cytogenetics: 4q12
• Summary: This gene encodes a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix. Mutations in this gene have been associated with limb-girdle muscular dystrophy.[provided by RefSeq, Oct 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis