OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

beta Sarcoglycan (SGCB) (NM_000232) Human Mass Spec Standard

Be the first to review this product
SKU
PH304699
SGCB MS Standard C13 and N15-labeled recombinant protein (NP_000223)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334661 Rabbit Polyclonal Anti-SGCB Antibody
100 ul
$585.00
LY400093 Transient overexpression lysate of sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB) (as WB positive control) 100 ug
$436.00

Other products for "beta Sarcoglycan or NM_000232"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204699
Predicted MW 34.8 kDa
Protein Sequence
Protein Sequence
>RC204699 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVII
LLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN
NQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQKASTERITS
NATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSG
DWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000223
RefSeq Size 4295
RefSeq ORF 954
Synonyms A3b; LGMD2E; LGMDR4; SGC
Locus ID 6443
UniProt ID Q16585
Cytogenetics 4q12
Summary This gene encodes a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix. Mutations in this gene have been associated with limb-girdle muscular dystrophy.provided by RefSeq, Oct 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "beta Sarcoglycan" proteins (3)
SKU Description Size Price
LC400093 Lyophilized SGCB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400093 Transient overexpression lysate of sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB) (as WB positive control) 100 ug
$436.00
TP304699 Recombinant protein of human sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products