PAH (NM_000277) Human Mass Spec Standard

SKU
PH304694
PAH MS Standard C13 and N15-labeled recombinant protein (NP_000268)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204694]
Predicted MW 51.8 kDa
Protein Sequence
Protein Sequence
>RC204694 protein sequence
Red=Cloning site Green=Tags(s)

MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPS
RLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGA
ELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEGKKTWGTVFKTLKSLYKTHACYEYNHIF
PLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPE
PDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSS
FGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR
IEVLDNTQQLKILADSINSEIGILCSALQKIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000268
RefSeq Size 2680
RefSeq ORF 1356
Synonyms PH; PKU; PKU1
Locus ID 5053
UniProt ID P00439
Cytogenetics 12q23.2
Summary This gene encodes a member of the biopterin-dependent aromatic amino acid hydroxylase protein family. The encoded phenylalanine hydroxylase enzyme hydroxylates phenylalanine to tyrosine and is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Phenylalanine, Phenylalanine metabolism, tyrosine and tryptophan biosynthesis
Write Your Own Review
You're reviewing:PAH (NM_000277) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424825 PAH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424825 Transient overexpression lysate of phenylalanine hydroxylase (PAH) 100 ug
$436.00
TP304694 Recombinant protein of human phenylalanine hydroxylase (PAH), 20 µg 20 ug
$867.00
TP762451 Purified recombinant protein of Human phenylalanine hydroxylase (PAH), full length, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.