PGCP (CPQ) (NM_016134) Human Mass Spec Standard

SKU
PH304684
PGCP MS Standard C13 and N15-labeled recombinant protein (NP_057218)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204684]
Predicted MW 51.9 kDa
Protein Sequence
Protein Sequence
>RC204684 protein sequence
Red=Cloning site Green=Tags(s)

MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALL
VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIG
TPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASF
SIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKY
PEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLH
KVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGA
SLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057218
RefSeq Size 1949
RefSeq ORF 1416
Synonyms LDP; PGCP
Locus ID 10404
UniProt ID Q9Y646
Cytogenetics 8q22.1
Summary This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids. [provided by RefSeq, Jul 2013]
Protein Families Protease
Write Your Own Review
You're reviewing:PGCP (CPQ) (NM_016134) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402505 CPQ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402505 Transient overexpression lysate of plasma glutamate carboxypeptidase (PGCP) 100 ug
$436.00
TP304684 Recombinant protein of human plasma glutamate carboxypeptidase (PGCP), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760108 Recombinant protein of human plasma glutamate carboxypeptidase (PGCP), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.