Galectin 1 (LGALS1) (NM_002305) Human Mass Spec Standard

SKU PH304674

LGALS1 MS Standard C13 and N15-labeled recombinant protein (NP_002296)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204674]
• Predicted MW: 14.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC204674 protein sequence; Red=Cloning site Green=Tags(s); ; MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG; TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002296
• RefSeq Size: 586
• RefSeq ORF: 405
• Synonyms: GAL1; GBP
• Locus ID: 3956
• UniProt ID: P09382
• Cytogenetics: 22q13.1
• Summary: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome