CDKN2AIP (NM_017632) Human Mass Spec Standard

SKU
PH304658
CDKN2AIP MS Standard C13 and N15-labeled recombinant protein (NP_060102)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204658]
Predicted MW 61.1 kDa
Protein Sequence
Protein Sequence
>RC204658 protein sequence
Red=Cloning site Green=Tags(s)

MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNR
QLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEP
SKKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSSTCIGSAIKSESGNSARSSGISSQNSSTSDGDRSV
SSQSSSSVSSQVTTAGSGKASEAEAPDKHGSSFVSLLKSSVNSHMTQSTDSRQQSGSPKKSALEGSSASA
SQSSSEIEVPLLGSSGSSEVELPLLSSKPSSETASSGLTSKTSSEASVSSSVAKNSSSSGTSLLTPKSSS
STNTSLLTSKSTSQVAASLLASKSSSQTSGSLVSKSTSLASVSQLASKSSSQTSTSQLPSKSTSQSSESS
VKFSCKLTNEDVKQKQPFFNRLYKTVAWKLVAVGGFSPNVNHGELLNAAIEALKATLDVFFVPLKELADL
PQNKSSQESIVCELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLLD
EESRPVNLPPALKHPQELL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060102
RefSeq Size 2391
RefSeq ORF 1737
Synonyms CARF
Locus ID 55602
UniProt ID Q9NXV6
Cytogenetics 4q35.1
Summary The protein encoded by this gene regulates the DNA damage response through several different signaling pathways. One such pathway is the p53-HDM2-p21(WAF1) pathway, which is critical to the DNA damage response. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:CDKN2AIP (NM_017632) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413633 CDKN2AIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413633 Transient overexpression lysate of CDKN2A interacting protein (CDKN2AIP) 100 ug
$436.00
TP304658 Recombinant protein of human CDKN2A interacting protein (CDKN2AIP), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.