OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cornulin (CRNN) (NM_016190) Human Mass Spec Standard

Be the first to review this product
SKU
PH304641
CRNN MS Standard C13 and N15-labeled recombinant protein (NP_057274)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811824 CRNN mouse monoclonal antibody,clone OTI4B8 100 ul
$447.00
LY414135 Transient overexpression lysate of cornulin (CRNN) (as WB positive control) 100 ug
$436.00

Other products for "Cornulin or NM_016190"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204641
Predicted MW 53.5 kDa
Protein Sequence
Protein Sequence
>RC204641 protein sequence
Red=Cloning site Green=Tags(s)

MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRLLDEDHTGTVE
FKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSGTEVGRAGKGQHYEGSSHRQS
QQGSRGQNRPGVQTQGQATGSAWVSSYDRQAESQSQERISPQIQLSGQTEQTQKAGEGKRNQTTEMRPER
QPQTREQDRAHQTGETVTGSGTQTQAGATQTVEQDSSHQTGRTSKQTQEATNDQNRGTETHGQGRSQTSQ
AVTGGHAQIQAGTHTQTPTQTVEQDSSHQTGSTSTQTQESTNGQNRGTEIHGQGRSQTSQAVTGGHTQIQ
AGSHTETVEQDRSQTVSHGGAREQGQTQTQPGSGQRWMQVSNPEAGETVPGGQAQTGASTEPGRQEWSST
HPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYL
RSTKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057274
RefSeq Size 1913
RefSeq ORF 1485
Synonyms C1orf10; DRC1; PDRC1; SEP53
Locus ID 49860
UniProt ID Q9UBG3
Cytogenetics 1q21.3
Summary This gene encodes a member of the "fused gene" family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation. provided by RefSeq, Jan 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Cornulin" proteins (4)
SKU Description Size Price
LC414135 Lyophilized CRNN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414135 Transient overexpression lysate of cornulin (CRNN) (as WB positive control) 100 ug
$436.00
TP304641 Recombinant protein of human cornulin (CRNN), 20 µg 20 ug
$867.00
TP720098 Recombinant protein of human cornulin (CRNN) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products