OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RBP4 (NM_006744) Human Mass Spec Standard

Be the first to review this product
SKU
PH304635
RBP4 MS Standard C13 and N15-labeled recombinant protein (NP_006735)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350338 Rabbit Polyclonal Anti-RBP4 Antibody
100 ul
$205.00
LY402016 Transient overexpression lysate of retinol binding protein 4, plasma (RBP4) (as WB positive control) 100 ug
$436.00

Other products for "RBP4 or NM_006744"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204635
Predicted MW 23 kDa
Protein Sequence
Protein Sequence
>RC204635 protein sequence
Red=Cloning site Green=Tags(s)

MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ
MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL
LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006735
RefSeq Size 941
RefSeq ORF 603
Synonyms MCOPCB10; RDCCAS
Locus ID 5950
UniProt ID P02753
Cytogenetics 10q23.33
Summary This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RBP4" proteins (4)
SKU Description Size Price
LC402016 Lyophilized RBP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402016 Transient overexpression lysate of retinol binding protein 4, plasma (RBP4) (as WB positive control) 100 ug
$436.00
TP304635 Recombinant protein of human retinol binding protein 4, plasma (RBP4), 20 µg 20 ug
$737.00
TP720147 Recombinant protein of human retinol binding protein 4, plasma (RBP4) 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products