TFIIB (GTF2B) (NM_001514) Human Mass Spec Standard

SKU
PH304607
GTF2B MS Standard C13 and N15-labeled recombinant protein (NP_001505)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204607]
Predicted MW 34.8 kDa
Protein Sequence
Protein Sequence
>RC204607 protein sequence
Red=Cloning site Green=Tags(s)

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDS
QNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNN
LFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLIT
TGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGV
ADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001505
RefSeq Size 1651
RefSeq ORF 948
Synonyms TF2B; TFIIB
Locus ID 2959
UniProt ID Q00403
Cytogenetics 1p22.2
Summary This gene encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Basal transcription factors
Write Your Own Review
You're reviewing:TFIIB (GTF2B) (NM_001514) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400582 GTF2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400582 Transient overexpression lysate of general transcription factor IIB (GTF2B) 100 ug
$436.00
TP304607 Recombinant protein of human general transcription factor IIB (GTF2B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720263 Recombinant protein of human general transcription factor IIB (GTF2B) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.