RAB3IL1 (NM_013401) Human Mass Spec Standard

SKU
PH304592
RAB3IL1 MS Standard C13 and N15-labeled recombinant protein (NP_037533)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204592]
Predicted MW 42.6 kDa
Protein Sequence
Protein Sequence
>RC204592 protein sequence
Red=Cloning site Green=Tags(s)

MWSGPPQPDQGLPPPLAAVPVPWKSTDPCQGHRESPGALVETSAGEEAQGQEGPAAAQLDVLRLRSSSME
IREKGSEFLKEELHRAQKELKLKDEECERLSKVREQLEQELEELTASLFEEAHKMVREANMKQAASEKQL
KEARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHKSTSSTLCPAVCPAAGHT
LTPDREGKEVDTILFAEFQAWRESPTLDKTCPFLERVYREDVGPCLDFTMQELSVLVRAAVEDNTLTIEP
VASQTLPTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITAVCNFFTYIRYIQQG
LVRQDAEPMFWEIMRLRKEMSLAKLGFFPQEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037533
RefSeq Size 2392
RefSeq ORF 1146
Synonyms GRAB
Locus ID 5866
UniProt ID Q8TBN0
Cytogenetics 11q12.2-q12.3
Summary This gene encodes a guanine nucleotide exchange factor for the ras-related protein Rab3A. The encoded protein binds Rab3a and the inositol hexakisphosphate kinase InsP6K1. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Nov 2012]
Write Your Own Review
You're reviewing:RAB3IL1 (NM_013401) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415621 RAB3IL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415621 Transient overexpression lysate of RAB3A interacting protein (rabin3)-like 1 (RAB3IL1) 100 ug
$436.00
TP304592 Recombinant protein of human RAB3A interacting protein (rabin3)-like 1 (RAB3IL1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.