OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB3IL1 (NM_013401) Human Mass Spec Standard

Be the first to review this product
SKU
PH304592
RAB3IL1 MS Standard C13 and N15-labeled recombinant protein (NP_037533)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504958 RAB3IL1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5) 100 ul
$447.00
LY415621 Transient overexpression lysate of RAB3A interacting protein (rabin3)-like 1 (RAB3IL1) (as WB positive control) 100 ug
$436.00

Other products for "RAB3IL1 or NM_013401"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204592
Predicted MW 42.6 kDa
Protein Sequence
Protein Sequence
>RC204592 protein sequence
Red=Cloning site Green=Tags(s)

MWSGPPQPDQGLPPPLAAVPVPWKSTDPCQGHRESPGALVETSAGEEAQGQEGPAAAQLDVLRLRSSSME
IREKGSEFLKEELHRAQKELKLKDEECERLSKVREQLEQELEELTASLFEEAHKMVREANMKQAASEKQL
KEARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHKSTSSTLCPAVCPAAGHT
LTPDREGKEVDTILFAEFQAWRESPTLDKTCPFLERVYREDVGPCLDFTMQELSVLVRAAVEDNTLTIEP
VASQTLPTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITAVCNFFTYIRYIQQG
LVRQDAEPMFWEIMRLRKEMSLAKLGFFPQEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037533
RefSeq Size 2392
RefSeq ORF 1146
Synonyms GRAB
Locus ID 5866
UniProt ID Q8TBN0
Cytogenetics 11q12.2-q12.3
Summary This gene encodes a guanine nucleotide exchange factor for the ras-related protein Rab3A. The encoded protein binds Rab3a and the inositol hexakisphosphate kinase InsP6K1. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 7. provided by RefSeq, Nov 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB3IL1" proteins (3)
SKU Description Size Price
LC415621 Lyophilized RAB3IL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415621 Transient overexpression lysate of RAB3A interacting protein (rabin3)-like 1 (RAB3IL1) (as WB positive control) 100 ug
$436.00
TP304592 Recombinant protein of human RAB3A interacting protein (rabin3)-like 1 (RAB3IL1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products