THRSP (NM_003251) Human Mass Spec Standard

SKU PH304567

THRSP MS Standard C13 and N15-labeled recombinant protein (NP_003242)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204567]
• Predicted MW: 16.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC204567 protein sequence; Red=Cloning site Green=Tags(s); ; MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDV; DHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQE; MTGQVW; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003242
• RefSeq Size: 1182
• RefSeq ORF: 438
• Synonyms: Lpgp; LPGP1; S14; SPOT14; THRP
• Locus ID: 7069
• UniProt ID: Q92748
• Cytogenetics: 11q14.1
• Summary: The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors