OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

THRSP (NM_003251) Human Mass Spec Standard

Be the first to review this product
SKU
PH304567
THRSP MS Standard C13 and N15-labeled recombinant protein (NP_003242)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401120 Transient overexpression lysate of thyroid hormone responsive (SPOT14 homolog, rat) (THRSP) (as WB positive control) 100 ug
$436.00

Other products for "THRSP or NM_003251"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204567
Predicted MW 16.6 kDa
Protein Sequence
Protein Sequence
>RC204567 protein sequence
Red=Cloning site Green=Tags(s)

MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDV
DHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQE
MTGQVW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003242
RefSeq Size 1182
RefSeq ORF 438
Synonyms Lpgp; LPGP1; S14; SPOT14; THRP
Locus ID 7069
UniProt ID Q92748
Cytogenetics 11q14.1
Summary The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "THRSP" proteins (3)
SKU Description Size Price
LC401120 Lyophilized THRSP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401120 Transient overexpression lysate of thyroid hormone responsive (SPOT14 homolog, rat) (THRSP) (as WB positive control) 100 ug
$436.00
TP304567 Recombinant protein of human thyroid hormone responsive (SPOT14 homolog, rat) (THRSP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products